PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_69304g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 342aa    MW: 37777.9 Da    PI: 6.02
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_69304g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer55.51.3e-17143191247
    ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegee...gtaaalkCaACg 47 
                    ++vrY+eC+kNhAa+lGg ++DGCgEfmp  +e    g+ a + C  C 
  MA_69304g0010 143 KAVRYRECQKNHAANLGGLVTDGCGEFMPGGEEXeveGEEAQIACDVCY 191
                    579**************************84332223567777777774 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.8E-15145191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.4E-15146190IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152318.421147200IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.1E-30243315IPR009057Homeodomain-like
SuperFamilySSF466892.32E-18247313IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-25255311IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDGKCKARHK TETCELTNIL TPALNFPRLG LEVCERAQDC RRKESINSRI SENNDTNPRE  60
DFYDADNEEE SPRFDGETPF QVSETSLRSG NFSMDIPGGE EEVISMPIST SFPAISDSSR  120
LRLLAAASTP EGKPPEKGLE GRKAVRYREC QKNHAANLGG LVTDGCGEFM PGGEEXEVEG  180
EEAQIACDVC YHKRLVPGST LLPLSFPQAA MGVLARPLPQ IIAAAPVNNN MKNSAVFVPS  240
PESEEQADGN LPSGKKRFRT KFTHEQKERM LAFAQRVGWR LQKHEEAAVQ SFCQEVGVRR  300
HVLKVWMHNN KHAMATKPHA DDNNHNNDNT AAANSSSNNS TP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-252563131875ZF-HD homeobox family protein
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1136752e-96BT113675.1 Picea glauca clone GQ03416_P14 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385095.11e-48hypothetical protein POPTR_0004s23860g, partial
STRINGPOPTR_0004s23860.14e-48(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.18e-32homeobox protein 22